PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof009413
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family DBB
Protein Properties Length: 268aa    MW: 28262.6 Da    PI: 5.6944
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-3971PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.11.5e-074587541
   zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                C+ +e   ++  C  ++  lC+ C +e+H        H++ p
  Sof009413 45 QCDACEAAAATVVCCADEAALCARCDVEIHAAnklaskHQRLP 87
               7******99*********************6678888888877 PP

2zf-B_box28.53.2e-0997128334
   zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeH 34 
                 ++C+ ++ek++ +fC +++ l+C+dC + +H
  Sof009413  97 LPRCDVCQEKPAFIFCVEDRALFCRDCDEPIH 128
                689**************************999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.8834188IPR000315B-box-type zinc finger
SMARTSM003362.8E-114188IPR000315B-box-type zinc finger
PfamPF006433.2E-54588IPR000315B-box-type zinc finger
SMARTSM003363.4E-1495142IPR000315B-box-type zinc finger
PROSITE profilePS501198.60395142IPR000315B-box-type zinc finger
PfamPF006434.5E-797138IPR000315B-box-type zinc finger
CDDcd000211.89E-898128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
XVAAGLPVSS GSREAPDYVR PESWVCRRAA EARSRRGAXG GMRIQCDACE AAAATVVCCA  60
DEAALCARCD VEIHAANKLA SKHQRLPLGD GDAAPSLPRC DVCQEKPAFI FCVEDRALFC  120
RDCDEPIHVP GTLSGNHQRY LATGIRVGFS SVCGAAGAEG IPPPAPPKGG SKPAAVGGAT  180
KTTTVKDTLP QEVPSSPFLP PSGWAVEDLL QLSDYESSDK KDSPLGFKEL EWFADIDLFH  240
AIRPAKTLTV EVPELLRLGG GQRATAGF
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.114240.0crown| leaf| meristem| root| seed| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448103.11e-122hypothetical protein SORBIDRAFT_06g021170
SwissprotQ962882e-64BBX24_ARATH; B-box zinc finger protein 24
TrEMBLC5YBE41e-122C5YBE4_SORBI; Putative uncharacterized protein Sb06g021170
STRINGSb06g021170.11e-122(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06040.12e-45DBB family protein